PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0293s0014.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 487aa    MW: 52637.3 Da    PI: 9.3594
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0293s0014.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.62.2e-32204259359
                          -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh 
  Kalax.0293s0014.1.p 204 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSF-DGHIAEIVYKGEHNHA 259
                          9***************************************.***************7 PP

2WRKY102.32.9e-32405462259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           Dgy+WrKYGqK+vkg+++prsYYrCts +C+v+k+ver++edp  +++tYeg+Hnh 
  Kalax.0293s0014.1.p 405 GDGYRWRKYGQKVVKGNPYPRSYYRCTSLKCNVRKHVERASEDPGSFITTYEGKHNHG 462
                          6********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-29195261IPR003657WRKY domain
SuperFamilySSF1182901.83E-25201261IPR003657WRKY domain
SMARTSM007742.7E-36202260IPR003657WRKY domain
PROSITE profilePS5081123.399204261IPR003657WRKY domain
PfamPF031067.6E-25204258IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.8E-34391464IPR003657WRKY domain
SuperFamilySSF1182903.14E-28398464IPR003657WRKY domain
PROSITE profilePS5081134.084399464IPR003657WRKY domain
SMARTSM007743.1E-37404463IPR003657WRKY domain
PfamPF031061.6E-25406461IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MEIKEAAADR VVIAKPVASK PTCSTYRSFS ELLAGAINDS PPPRDPAVAA AIRPKTVRVA  60
KPTPAPAAQP PPSVSQSRAE VSKAAAPGPG QSLDTLLATD TKTSVVYKPL AKVVSKSTVS  120
LLANMGNFDK SPQPSQVEPR PQQLLRPQGW HLRSNQGPQS GMSSQPEPSR LPETSRGQPS  180
SQNTEEDENS VIPAVANVDR PSYDGYNWRK YGQKQVKGSE YPRSYYKCTH PNCPVKKKVE  240
RSFDGHIAEI VYKGEHNHAK PQPPKKNTPA AAAQANGSEG TGQDFGANIN SSQYLNDARH  300
EASDIRSENQ NEMLRSSAIP AYHASNPALS FDNVANAGLG TPENSCGVSG EHEELSKGID  360
ADEEEPKSKR RKSEVQPSDP AGPSGHTMQV PKIVVQSSTD NEIVGDGYRW RKYGQKVVKG  420
NPYPRSYYRC TSLKCNVRKH VERASEDPGS FITTYEGKHN HGKPARTDTQ PASEQGSQSQ  480
ASKDIK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-30204465878Probable WRKY transcription factor 4
2lex_A3e-30204465878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010653472.11e-172PREDICTED: WRKY transcription factor 44
RefseqXP_010653471.11e-172PREDICTED: WRKY transcription factor 44
RefseqXP_010653470.11e-172PREDICTED: WRKY transcription factor 44
RefseqXP_002275978.11e-172PREDICTED: WRKY transcription factor 44
TrEMBLF6HQV71e-172F6HQV7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0040g03070.t011e-171(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.19e-90WRKY family protein